Recombinant S. cerevisiae TIM16

Instruction Manual!

Product name:	Recombinant S. cerevisiae TIM16
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM Tris,300mM NaCl,pH8.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant S. cerevisiae Mitochondrial Import Inner Membrane Translocase Subunit TIM16 is produced by our E.coli expression system and the target gene encoding Thr54-Ala119 is expressed.
Names	Mitochondrial import inner membrane translocase subunit TIM16; Presequence translocated-associated motor subunit PAM16; PAM16; TIM16
Accession #	P42949
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM Tris,300mM NaCl,pH8.0.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MTLDESCKILNIEESKGDLNMDKINNRFNYLFEVNDKEKGGSFYLQSKVYRAAERLKWELAQREK NA
Background	Mitochondrial import inner membrane translocase subunit TIM16 (TIM16) is an ssential component of the PAM complex. PAM complex is required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. In the complex, TIM16 is required to regulate activity of mtHSP70 (SSC1) via its interaction with PAM18/TIM14. TIM16 may act by positioning PAM18/TIM14 in juxtaposition to mtHSP70 at the translocon to maximize ATPase stimulation.