Recombinant Human Cyclin-Dependent Kinase 6/CDK6

Instruction Manual!

Product name:	Recombinant Human Cyclin-Dependent Kinase 6/CDK6
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 50mM Tris, 100mM NaCl, 20% Glycerol, 5mM DTT, pH 8.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human Cyclin-Dependent Kinase 6 is produced by our E.coli expression system and the target gene encoding Met1-Ala326 is expressed with a 6His tag at the N-terminus.
Names	Cyclin-Dependent Kinase 6, Cell Division Protein Kinase 6, Serine/Threonine-Protein Kinase PLSTIRE, CDK6, CDKN6
Accession #	Q00534
Formulation	Supplied as a 0.2 μm filtered solution of 50mM Tris, 100mM NaCl, 20% Glycerol, 5mM DTT, pH 8.0.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Biological Activity	IN STOCK
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MGSSHHHHHHSSGLVPRGSHMEKDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRV RVQTGEEGMPLSTIREVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLD KVPEPGVPTETIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMA LTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGE EDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQDLER CKENLDSHLPPSQNTSELNTA
Background	Cyclin-Dependent Kinase 6 (CDK6 belongs to the CMGC Ser/Thr protein kinase family and CDC2/CDKX subfamily. CDK6 is expressed in many tissues and contains one protein kinase domain. This cyclin forms a complex with and functions as a regulatory subunit of CDK4 or CDK6, whose activity is required for cell cycle G1/S transition. Mutations and overexpression of CDK6, which alters cell cycle progression, are observed frequently in a variety of tumors and may contribute to tumorigenesis.