Recombinant Human Estrogen Receptor β/ERβ/NR3A2

Instruction Manual!

Product name:	Recombinant Human Estrogen Receptor β/ERβ/NR3A2
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 50mM TrisHCl，pH8.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human Estrogen Receptor Beta is produced by our E.coli expression system and the target gene encoding Met1-Ala323 is expressed with a 6His tag at the N-terminus.
Names	Estrogen Receptor Beta, ER-Beta, Nuclear Receptor Subfamily 3 Group A Member 2, ESR2, ESTRB, NR3A2
Accession #	Q92731-3
Formulation	Lyophilized from a 0.2 μm filtered solution of 50mM TrisHCl，pH8.0.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Biological Activity	IN STOCK
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MGSSHHHHHHSSGLVPRGSHMDIKNSPSSLNSPSSYNCSQSILPLEHGSIYIPSSYVDSHHEYPA MTFYSPAVMNYSIPSNVTNLEGGPGRQTTSPNVLWPTPGHLSPLVVHRQLSHLYAEPQKSPWCEA RSLEHTLPVNRETLKRKVSGNRCASPVTGPGSKRDAHFCAVCSDYASGYHYGVWSCEGCKAFFKR SIQGHNDYICPATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRRERCGYRLVRRQRSADEQLH CAGKAKRSGGHAPRVRELLLDALSPEQLVLTLLEAEPPHVLISRPSAPFTEASMMMSLTKLADKE LVHMISWAKKIPGMRGNA
Background	Estrogen Receptor Beta (ESR2) is a nuclear protein that belongs to the nuclear hormone receptor family of NR3 subfamily. It contains one nuclear receptor DNA-binding domain and is expressed in many tissues at a lower level. ESR2 is a nuclear hormone receptor. It binds estrogens with an affinity similar to that of ESR1 and activates expression of reporter genes containing estrogen response elements (ERE) in an estrogen-dependent manner. DNA-binding by ESR1 and ESR2 is rapidly lost at 37 degrees Celsius in the absence of ligand while in the presence of 17 beta-estradiol and 4-hydroxy-tamoxifen loss in DNA-binding at elevated temperature is more gradual.