Recombinant Human Insulin-Like Growth Factor II/IGF2

Instruction Manual!

Product name:	Recombinant Human Insulin-Like Growth Factor II/IGF2
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 5mM Hac, pH ~3.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human Insulin-Like Growth Factor II is produced by our E.coli expression system and the target gene encoding Ala25-Glu91 is expressed.
Names	Insulin-Like Growth Factor II, IGF-II, Somatomedin-A, IGF2, PP1446
Accession #	P01344
Formulation	Lyophilized from a 0.2 μm filtered solution of 5mM Hac, pH ~3.0.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MFPAMPLSSLFVNAYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCD LALLETYCATPAKSE
Background	Insulin-Like Growth Factor II (IGF2) belongs to the insulin family of polypeptide growth factors that is involved in development and growth. Members of this family are structurally homologous to proinsulin, and share higher sequence identity. IGF2 is expressed only from the paternally inherited allele and believed to be secreted by the liver and to circulate in the blood. IGF2 possess growth-promoting activity and can stimulate the proliferation and survival of various cell types including muscle, bone, and cartilage tissue in vitro. IGF2 is influenced by placental lactogen and may play a role in fetal development.