Recombinant Human Protein Down-Regulator of Transcription 1/DR1/NC2-β

Instruction Manual!

Product name:	Recombinant Human Protein Down-Regulator of Transcription 1/DR1/NC2-β
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, 1mM DTT, pH 8.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human NC2-beta is produced by our E.coli expression system and the target gene encoding Ala2-Ile176 is expressed with a 6His tag at the C-terminus.
Names	Protein Dr1, Down-Regulator of Transcription 1, Negative Cofactor 2-Beta, NC2-Beta, TATA-Binding Protein-Associated Phosphoprotein, DR1
Accession #	Q01658
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, 1mM DTT, pH 8.0.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Biological Activity	IN STOCK
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	ASSSGNDDDLTIPRAAINKMIKETLPNVRVANDARELVVNCCTEFIHLISSEANEICNKSEKKTI SPEHVIQALESLGFGSYISEVKEVLQECKTVALKRRKASSRLENLGIPEEELLRQQQELFAKARQ QQAELAQQEWLQMQQAAQQAQLAAASASASNQAGSSQDEEDDDDIVEHHHHHH
Background	Protein Dr1 (DR1) belongs to the NC2 beta/DR1 family. DR1 contains a histone fold motif at the amino terminus, a TBP-binding domain, and a glutamine- and alanine-rich region. DR1 as a TBP associated phosphoprotein that represses both basal and activated levles of transcription. DR1 is an component of the ADA2A-containing complex (ATAC) which posses histone acetyltransferase activity on histone H3 and H4.