Recombinant Human CDC73/Parafibromin/HRPT2

Instruction Manual!

Product name:	Recombinant Human CDC73/Parafibromin/HRPT2
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human CDC73 is produced by our E.coli expression system and the target gene encoding Met1-Glu260 is expressed with a 6His tag at the N-terminus.
Names	Parafibromin, Cell Division Cycle Protein 73 Homolog, Hyperparathyroidism 2 Protein, CDC73, C1orf28, HRPT2
Accession #	Q6P1J9
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Biological Activity	IN STOCK
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MGSSHHHHHHSSGLVPRGSHMADVLSVLRQYNIQKKEIVVKGDEVIFGEFSWPKNVKTNYVVWGT GKEGQPREYYTLDSILFLLNNVHLSHPVYVRRAATENIPVVRRPDRKDLLGYLNGEASTSASIDR SAPLEIGLQRSTQVKRAADEVLAEAKKPRIEDEECVRLDKERLAARLEGHKEGIVQTEQIRSLSE AMSVEKIAAIKAKIMAKKRSTIKTDLDDDITALKQRSFVDAEVDVTRDIVSRERVWRTRTTILQS TGKNFSKNIFAILQSVKARELEHHHHHH
Background	Parafibromin is expressed in the adrenal and parathyroid glands, kidney, and heart. As a tumor supressor, Parafibromin may be involved in transcriptional and post-transcriptional control pathways, also through the regulation of cyclin D1/PRAD1 expression, involved the cell cycle progression. Parafibromin is a component of the the PAF protein complex and interacts with a Set1-like complex that has histone methyltransferase activity and methylates histone H3. Defects in Parafibromin can cause hyperparathyroidism-jaw tumor syndrome, familial isolated hyperparathyroidism, and parathyroid carcinoma.