Recombinant Human Checkpoint Protein HUS1

Instruction Manual!

Product name:	Recombinant Human Checkpoint Protein HUS1
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 100mM NaCl, 40% Glycerol, pH 8.0 .
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human Checkpoint Protein HUS1 is produced by our E.coli expression system and the target gene encoding Met1-Ser280 is expressed with a 6His tag at the N-terminus.
Names	Checkpoint Protein HUS1, hHUS1, HUS1
Accession #	O60921
Formulation	Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 100mM NaCl, 40% Glycerol, pH 8.0 .
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Biological Activity	IN STOCK
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MGSSHHHHHHSSGLVPRGSHMKFRAKIVDGACLNHFTRISNMIAKLAKTCTLRISPDKLNFILCD KLANGGVSMWCELEQENFFNEFQMEGVSAENNEIYLELTSENLSRALKTAQNARALKIKLTNKHF PCLTVSVELLSMSSSSRIVTHDIPIKVIPRKLWKDLQEPVVPDPDVSIYLPVLKTMKSVVEKMKN ISNHLVIEANLDGELNLKIETELVCVTTHFKDLGNPPLASESTHEDRNVEHMAEVHIDIRKLLQF LAGQQVNPTKALCNIVNNKMVHFDLLHEDVSLQYFIPALSVEHHHHHH
Background	Checkpoint protein HUS1 is a member of the HUS1 family, members of which are shuttled between the nucleus and cytoplasm. HUS1 is expressed in many tissues. HUS1 is a component of an evolutionarily conserved, genotoxin-activated checkpoint complex involved in arresting the cell cycle in response to DNA damage. DNA damage induced chromatin binding has been shown to depend on the activation of the checkpoint kinase ATM, and is thought to be an early checkpoint signaling event. HUS1 binds with Rad9 and Rad1 to form the 9-1-1 (RAD9-RAD1-HUS1) complex, which localizes to DNA lesions and promotes DNA damage signaling and repair or apoptosis and cell cycle arrest.