Recombinant Human Aldehyde Dehydrogenase 1-A2/ALDH1A2
| Product name: | Recombinant Human Aldehyde Dehydrogenase 1-A2/ALDH1A2 |
| Source: | E.coli |
| Purity: | Greater than 95% as determined by reducing SDS-PAGE. |
| Buffer Formulation: | Supplied as a 0.2 μm filtered solution of 20mM TrisHCl,150mMNaCl, pH7.5,20% Glycerol. |
| Applications: | Applications:SDS-PAGE; WB; ELISA; IP. |
| Storage: | Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months. |
| UOM: | 100ug/50ug/200ug/1mg/1g |
| Source | E.coli |
| Description | Recombinant Human Aldehyde dehydrogenase 1-A2 is produced by our E.coli expression system and the target gene encoding Met1-Ser518 is expressed with a 6His tag at the N-terminus. |
| Names | Aldehyde dehydrogenase family 1 member A2, Retinaldehyde-specific dehydrogenase type 2, RALDH(II), Retinal dehydrogenase 2, ALDH1A2, RALDH2 |
| Accession # | O94788 |
| Formulation | Supplied as a 0.2 μm filtered solution of 20mM TrisHCl,150mMNaCl, pH7.5,20% Glycerol. |
| Shipping |
The product is shipped on dry ice/ice packs. |
| Storage |
Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
| Endotoxin | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
| Amino Acid Sequence |
MNHKVHHHHHHMTSSKIEMPGEVKADPAALMASLHLLPSPTPNLEIKYTKIFINNEWQNSESGRV FPVYNPATGEQVCEVQEADKADIDKAVQAARLAFSLGSVWRRMDASERGRLLDKLADLVERDRAV LATMESLNGGKPFLQAFYVDLQGVIKTFRYYAGWADKIHGMTIPVDGDYFTFTRHEPIGVCGQII PWNFPLLMFAWKIAPALCCGNTVVIKPAEQTPLSALYMGALIKEAGFPPGVINILPGYGPTAGAA IASHIGIDKIAFTGSTEVGKLIQEAAGRSNLKRVTLELGGKSPNIIFADADLDYAVEQAHQGVFF NQGQCCTAGSRIFVEESIYEEFVRRSVERAKRRVVGSPFDPTTEQGPQIDKKQYNKILELIQSGV AEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFG LVAAVFTNDINKALTVSSAMQAGTVWINCYNALNAQSPFGGFKMSGNGREMGEFGLREYSEVKTV TVKIPQKNS
|
| Background | Aldehyde dehydrogenase 1 family member A2 (ALDH1A2), also known as retinaldehyde dehydrogenase 2 (RALDH2), belongs to the aldehyde dehydrogenase family which contains two members, the ALDH1 s (ALDH1A1, ALDH1A2 and ALDH1A3) and the 9-cis retinaldehyde dehydrogenase ALDH8 s. ALDH1A2 is key enzyme that catalyzes the synthesis of retinoic acid (RA) from retinaldehyde. RA is a paracrine hormone signaling molecule that functions in developing and adult tissues. ALDH1A2 was also found to regulate normal and tumor cell growth and differentiation. Several studies showed that ALDH1A2 expression is increased after the appearance of AraC resistance in clinical cases which means this protein is effective in AraC resistance. |












