Recombinant Mouse S100 Calcium Binding Protein A15A/S100A15A

Instruction Manual!

Product name:	Recombinant Mouse S100 Calcium Binding Protein A15A/S100A15A
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	10ug/50ug/100ug/200ug/1mg

Source	E.coli
Description	Recombinant Mouse S100 calcium binding protein A15A is produced by our E.coli expression system and the target gene encoding Met1-Tyr108 is expressed.
Names	S100 calcium-binding protein A15A, Protein S100-A15A, Protein S100-A7A, S100 calcium-binding protein A7A, S100a15a
Accession #	Q6S5I3
Formulation	Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MPDTPVEDSLFQIIHCFHHYAAREGDKETLSLEELKALLLDSVPRFMDTLGRRQPYYITELFRAA DKNKDNQICFDEFLYILGKLVKDYHLQFHRQLCAHYCTEHSLY