Recombinant Human Brain Natriuretic Peptide/BNP

Instruction Manual!

Product name:	Recombinant Human Brain Natriuretic Peptide/BNP
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4.
Applications:	Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human Brain-type Natriuretic Peptide is produced by our E.coli expression system and the target gene encoding His27-Arg102 is expressed with a 6His, Flag tag at the N-terminus.
Names	Natriuretic peptides B, Gamma-brain natriuretic peptide, NPPB, BNP
Accession #	P16860
Formulation	Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MNHKVHHHHHHMDYKDDDDKHPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESP RPTGVWKSREVATEGIRGHRKMVLYTLRAPR
Background	Brain-type Natriuretic Peptide (BNP) is a nonglycosylated peptide that is produced predominantly by ventricular myocytes and belongs to the natriuretic peptide family. Proteolytic cleavage of the 12 kDa BNP precursor gives rise to N-terminal Pro BNP (NT-proBNP) and mature BNP. N-terminal proB-type natriuretic peptide (NT-proBNP), a useful marker of heart failure (HF), is considered to be secreted mainly from the ventricle, increased serum NT-proBNP levels are also encountered in conditions such as atrial fibrillation (AF) and atrial septal defect in patients without HF.