Recombinant Human Acylphosphate Phosphohydrolase 1/ACYP1

Instruction Manual!

Product name:	Recombinant Human Acylphosphate Phosphohydrolase 1/ACYP1
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM Tris,100mM NaCl,20% Glycerol,1mM DTT,pH8.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human Acylphosphate phosphohydrolase 1 is produced by our E.coli expression system and the target gene encoding Met1-Lys99 is expressed with a 6His tag at the N-terminus.
Names	Acylphosphatase-1,ACYP1,Acylphosphatase, erythrocyte isozyme,Acylphosphatase, organ-common type isozyme,Acylphosphate phosphohydrolase 1,ACYPE
Accession #	P07311
Formulation	Supplied as a 0.2 μm filtered solution of 20mM Tris,100mM NaCl,20% Glycerol,1mM DTT,pH8.0.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MGSSHHHHHHSSGLVPRGSHMAEGNTLISVDYEIFGKVQGVFFRKHTQAEGKKLGLVGWVQNTDR GTVQGQLQGPISKVRHMQEWLETRGSPKSHIDKANFNNEKVILKLDYSDFQIVK
Background	ACYP1, also known as Acylphosphatase-1, Acylphosphatase, erythrocyte isozyme, Acylphosphatase, organ-common type isozyme, Acylphosphate phosphohydrolase 1 and ACYPE, is a small cytosolic enzyme which catalyzes the hydrolysis of the carboxyl-phosphate bond of acylphosphates.ACYP1 is a protein which belongs to the acylphosphatase family and contains 1 fibrinogen C-terminal domain. Two isoenzymes have been isolated, called muscle acylphosphatase and erythrocyte acylphosphatase, on the basis of their tissue localization. This gene encodes the erythrocyte acylphosphatase isoenzyme. Alternatively spliced transcript variants that encode different proteins were identified through data analysis. Recombinant human ACYP1 protein was expressed in E. coli fused with HIS-tag at N-terminus.