Recombinant Human S100 Calcium Binding Protein A8/A9 Heterodimer
Product name: | Recombinant Human S100 Calcium Binding Protein A8/A9 Heterodimer |
Source: | E.coli |
Purity: | Greater than 95% as determined by reducing SDS-PAGE. |
Buffer Formulation: | Supplied as a 0.2 μm filtered solution of 20mM HEPES,10%Glycerol,150mM NaCl,2.5mM EDTA,pH 7.4. |
Applications: | Applications:SDS-PAGE; WB; ELISA; IP. |
Storage: | Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months. |
UOM: | 100ug/50ug/200ug/1mg/1g |
Source | E.coli |
Description | Recombinant Human S100A8 & S100A9 Heterodimer is produced by our E.coli expression system and the target gene encoding Met1-Glu93(S100A8)&Thr2-Pro114(S100A9) is expressed with a 6His tag at the C-terminus. |
Names | S100A8/S100A9 Heterodimer |
Accession # | P05109 & P06702 |
Formulation | Supplied as a 0.2 μm filtered solution of 20mM HEPES,10%Glycerol,150mM NaCl,2.5mM EDTA,pH 7.4. |
Shipping |
The product is shipped on dry ice/ice packs. |
Storage |
Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
Endotoxin | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
Amino Acid Sequence |
MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGA VNFQEFLILVIKMGVAAHKKSHEESHKEHHHHHH&TCKMSQLERNIETIINTFHQYSVKLGHPDT LNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHE GDEGPGHHHKPGLGEGTP
|
Background | S100A8 is a member of the S100 family, EF-hand superfamily of Ca-binding proteins. It is produced by neutrophils and monocytes, and forms Ca2+-dependent heterodimer/heterotetramer complexes (termed calprotectin) with S100A9. Calprotectin (S100A8/A9) which has a wide plethora of intra- and extracellular functions. The intracellular functions include: facilitating leukocyte arachidonic acid trafficking and metabolism, modulation of the tubulin-dependent cytoskeleton during migration of phagocytes and activation of the neutrophilic NADPH-oxidase. |