Recombinant Human Fibroblast Growth Factor 6/FGF-6

Instruction Manual!

Product name:	Recombinant Human Fibroblast Growth Factor 6/FGF-6
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM Tris,500mM NaCl,pH8.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human Fibroblast Growth Factor 6 is produced by our E.coli expression system and the target gene encoding Gly41-Ile208 is expressed.
Names	Fibroblast Growth Factor 6, FGF-6, Heparin Secretory-Transforming Protein 2, HST-2, HSTF-2, Heparin-Binding Growth Factor 6, HBGF-6, FGF6, HST2, HSTF2
Accession #	P10767
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM Tris,500mM NaCl,pH8.0.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	GTRANNTLLDSRGWGTLLSRSRAGLAGEIAGVNWESGYLVGIKRQRRLYCNVGIGFHLQVLPDGR ISGTHEENPYSLLEISTVERGVVSLFGVRSALFVAMNSKGRLYATPSFQEECKFRETLLPNNYNA YESDLYQGTYIALSKYGRVKRGSKVSPIMTVTHFLPRI
Background	Fibroblast Growth Factor 6 (FGF-6) is a secreted protein member of the heparin-binding growth factors family. FGF family members possess broad mitosis and cell survival activities and are involved in a variety of biological processes. Affinity between fibroblast growth factors (FGFs) and their receptors is increased by heparan sulfate glycosaminoglycans that function as coreceptors. FGF6 plays an important role in the regulation of cell proliferation, cell differentiation, angiogenesis and myogenesis, and is required for normal muscle regeneration.