Recombinant Human Zinc Finger BED Domain-Containing Protein 1/ZBED1

Instruction Manual!

Product name:	Recombinant Human Zinc Finger BED Domain-Containing Protein 1/ZBED1
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human Zinc Finger BED Domain-Containing Protein 1 is produced by our E.coli expression system and the target gene encoding Asn3-Glu100 is expressed with a 6His tag at the C-terminus.
Names	Zinc Finger BED Domain-Containing Protein 1, Putative Ac-Like Transposable Element, dREF Homolog, ZBED1, ALTE, DREF, KIAA0785, TRAMP
Accession #	O96006
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MNKSLESSQTDLKLVAHPRAKSKVWKYFGFDTNAEGCILQWKKIYCRICMAQIAYSGNTSNLSYH LEKNHPEEFCEFVKSNTEQMREAFATAFSKLKPELEHHHHHH
Background	Zinc Finger BED Domain-Containing Protein 1 (ZBED1) contains one BED-type zinc finger and is found in the cell nucleus. ZBED1 is widely expressed, highly in heart, skeletal muscle, spleen and placenta. The expression of ZBED1 is usually linked to the cell cycle. During the G1/S phase, the expression is increasing. During the S/G2 phage, the expression reaches to the highest, and then decreasing. ZBED1 exists in homodimer forms, which can bind to 5’-TGTCCG[CT]GA[CT]A-3’ DNA elements, that can be found in the promoter regions of a number of gene related to cell proliferation.