Recombinant Human NIP7/KD93

Instruction Manual!

Product name:	Recombinant Human NIP7/KD93
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 100mM NaCl, pH 8.0 .
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human NIP7 is produced by our E.coli expression system and the target gene encoding Met1-Thr180 is expressed with a 6His tag at the N-terminus.
Names	60S Ribosome Subunit Biogenesis Protein NIP7 Homolog, KD93, NIP7
Accession #	Q9Y221
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 100mM NaCl, pH 8.0 .
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MGSSHHHHHHSSGLVPRGSHMRPLTEEETRVMFEKIAKYIGENLQLLVDRPDGTYCFRLHNDRVY YVSEKIMKLAANISGDKLVSLGTCFGKFTKTHKFRLHVTALDYLAPYAKYKVWIKPGAEQSFLYG NHVLKSGLGRITENTSQYQGVVVYSMADIPLGFGVAAKSTQDCRKVDPMAIVVFHQADIGEYVRH EETLT
Background	60S Ribosome Subunit Biogenesis Protein NIP7 Homolog (NIP7) belongs to the NIP7 family. NIP7 contains one PUA domain, it is essential for the process of proper 27S pre-rRNA and 60S ribosome subunit assembly. NIP7 is a monomer form and interacts with NOL8 and SBDS, and may bind to RNA. In addition, NIP7 is one of the many trans-acting factors required for eukaryotic ribosome biogenesis, which interacts with nascent pre-ribosomal particles and dissociates as they complete maturation and are exported to the cytoplasm.