Recombinant Human GABA Receptor-Associated Protein-Like 1/GABARAPL1

Instruction Manual!

Product name:	Recombinant Human GABA Receptor-Associated Protein-Like 1/GABARAPL1
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human GABARAPL1 is produced by our E.coli expression system and the target gene encoding Met1-Lys117 is expressed with a 6His tag at the N-terminus.
Names	Gamma-Aminobutyric Acid Receptor-Associated Protein-Like 1, Early Estrogen-Regulated Protein, GABA(A) Receptor-Associated Protein-Like 1, Glandular Epithelial Cell Protein 1, GEC-1, GABARAPL1, GEC1
Accession #	Q9H0R8
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MGSSHHHHHHSSGLVPRGSHMKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLD KRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYS DESVYGK
Background	Gamma-Aminobutyric Acid Receptor-Associated Protein-Like 1 (GABARAPL1) is a cytoplasmic protein that belongs to the MAP1 LC3 family. GABARAPL1 is expressed at very high levels in the brain, heart, peripheral blood leukocytes, liver, kidney, placenta, and skeletal muscle. It can interact with GABRG2, OPRK1 and β-Tubulin. GABARAPL1 increases cell-surface expression of kappa-type opioid receptor through facilitating anterograde intracellular trafficking of the receptor.