Recombinant Human PBLD/MAWBP

Instruction Manual!

Product name:	Recombinant Human PBLD/MAWBP
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM Tris, 100mM NaCl, 1mM DTT, 30% Glycerol, pH 8.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human PBLD is produced by our E.coli expression system and the target gene encoding Met1-Ala288 is expressed with a 6His tag at the N-terminus.
Names	Phenazine Biosynthesis-Like Domain-Containing Protein, MAWD-Binding Protein, MAWDBP, Unknown Protein 32 From 2D-PAGE of Liver Tissue, PBLD, MAWBP
Accession #	P30039
Formulation	Supplied as a 0.2 μm filtered solution of 20mM Tris, 100mM NaCl, 1mM DTT, 30% Glycerol, pH 8.0.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MGSSHHHHHHSSGLVPRGSHMKLPIFIADAFTARAFRGNPAAVCLLENELDEDMHQKIAREMNLS ETAFIRKLHPTDNFAQSSCFGLRWFTPASEVPLCGHATLASAAVLFHKIKNMNSTLTFVTLSGEL RARRAEDGIVLDLPLYPAHPQDFHEVEDLIKTAIGNTLVQDICYSPDTQKLLVRLSDVYNRSFLE NLKVNTENLLQVENTGKVKGLILTLKGEPGGQTQAFDFYSRYFAPWVGVAEDPVTGSAHAVLSSY WSQHLGKKEMHAFQCSHRGGELGISLRPDGRVDIRGGAAVVLEGTLTA
Background	Phenazine Biosynthesis-Like Domain-Containing protein (PBLD) belongs to the phenazine biosynthesis-like protein (PhzF) family, which is expressed in most tissues. PBLD takes part in the MAPK signaling pathway, and is involved in multiple basic cellular functions. The expression of PBLD can be increased in several disease processes, including insulin resistance, folate deficiency and hypotension.