elisa kit elisa kits logo

Tel:631-424-0089
Fax:631-424-0095
Email: info@immunoclone.com

Home>>Products >>  Proteins

Recombinant Human EIF1A, X-Chromosomal/EIF1AX

Recombinant Human EIF1A, X-Chromosomal/EIF1AX Recombinant Human EIF1A, X-Chromosomal/EIF1AX

Instruction Manual!

Product name: Recombinant Human EIF1A, X-Chromosomal/EIF1AX
Source:E.coli
Purity:Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
Applications:Applications:SDS-PAGE; WB; ELISA; IP.
Storage:Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:100ug/50ug/200ug/1mg/1g
Source E.coli
Description Recombinant Human EIF1AX is produced by our E.coli expression system and the target gene encoding Met1-Ile144 is expressed with a 6His tag at the N-terminus.
Names Eukaryotic Translation Initiation Factor 1A X-Chromosomal, eIF-1A X Isoform, Eukaryotic Translation Initiation Factor 4C, eIF-4C, EIF1AX, EIF1A, EIF4C
Accession # P47813
Formulation Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
Shipping The product is shipped at ambient temperature.
Reconstitution Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence
MGSSHHHHHHSSGLVPRGSHMPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNG RLEAMCFDGVKRLCHIRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELP EHAKINETDTFGPGDDDEIQFDDIGDDDEDIDDI
Background Eukaryotic Translation Initiation Factor 1A, X-Chromosomal (EIF1AX) is an essential eukaryotic translation initiation factor that belongs to the eIF-1A family. EIF1AX is required for the binding of the 43S complex (a 40S subunit, eIF2/GTP/Met-tRNAi and eIF3) to the 5' end of capped RNA and has been shown to interact with IPO13. EIF1AX contains one S1-like domain and seems to be required for maximal rate of protein biosynthesis. Enhances ribosome dissociation into subunits and stabilizes the binding of the initiator Met-tRNA(I) to 40 S ribosomal subunits.

Copyright @ USA Immuno Clone Co., Ltd(I&C) All Rights Reserved Language:Chinese