Recombinant Human Phosphopantothenoylcysteine Decarboxylase/PPC-DC

Instruction Manual!

Product name:	Recombinant Human Phosphopantothenoylcysteine Decarboxylase/PPC-DC
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 50mM NaCl, 1mM DTT, 10% Glycerol, pH 8.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human PPC-DC is produced by our E.coli expression system and the target gene encoding Met1-Ser204 is expressed with a 6His tag at the N-terminus.
Names	Phosphopantothenoylcysteine Decarboxylase, PPC-DC, PPCDC, COAC
Accession #	Q96CD2
Formulation	Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 50mM NaCl, 1mM DTT, 10% Glycerol, pH 8.0.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MGSSHHHHHHSSGLVPRGSHMEPKASCPAAAPLMERKFHVLVGVTGSVAALKLPLLVSKLLDIPG LEVAVVTTERAKHFYSPQDIPVTLYSDADEWEMWKSRSDPVLHIDLRRWADLLLVAPLDANTLGK VASGICDNLLTCVMRAWDRSKPLLFCPAMNTAMWEHPITAQQVDQLKAFGYVEIPCVAKKLVCGD EGLGAMAEVGTIVDKVKEVLFQHSGFQQS
Background	Phosphopantothenoylcysteine Decarboxylase (PPC-DC) is an essential enzyme in the biosynthesis ofCoenzyme A and catalyzes the decarboxylation of PPC to Phosphopantetheine. PPC-DC catalyzes the decarboxylation of the Cysteine moiety of 4-Phosphopantothenoylcysteine (PPC) to form 4-Phosphopantetheine (PPantSH), this reaction forms part of the biosynthesis of Coenzyme A. The enzyme is a member of the larger family of Cysteine Decarboxylases including the Lantibiotic-Biosynthesizing enzymes EpiD and MrsD, all of which use a tightly bound Flavin cofactor to oxidize the Thiol moiety of the substrate to a Thioaldehyde.