Recombinant Human Fatty Acid-Binding Protein 6/FABP6/I-BABP
Product name: | Recombinant Human Fatty Acid-Binding Protein 6/FABP6/I-BABP |
Source: | E.coli |
Purity: | Greater than 95% as determined by reducing SDS-PAGE. |
Buffer Formulation: | Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 0.5mM DTT, 50% Glycerol, pH 8.0. |
Applications: | Applications:SDS-PAGE; WB; ELISA; IP. |
Storage: | Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months. |
UOM: | 100ug/50ug/200ug/1mg/1g |
Source | E.coli |
Description | Recombinant Human FABP6 is produced by our E.coli expression system and the target gene encoding Met1-Ala128 is expressed with a 6His tag at the N-terminus. |
Names | Gastrotropin, GT, Fatty Acid-Binding Protein 6, Ileal Lipid-Binding Protein, ILBP, Intestinal 15 kDa Protein, I-15P, Intestinal Bile Acid-Binding Protein, I-BABP, FABP6, ILBP, ILLBP |
Accession # | P51161 |
Formulation | Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 0.5mM DTT, 50% Glycerol, pH 8.0. |
Shipping |
The product is shipped on dry ice/ice packs. |
Storage |
Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
Endotoxin | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
Amino Acid Sequence |
MGSSHHHHHHSSGLVPRGSHMAFTGKFEMESEKNYDEFMKLLGISSDVIEKAHNFKIVTEVQQDG QDFTWSQHYYGGHTMTNKFTVGKESNIQTMGGKTFKATVQMEGGKLVVNFPNYHQTSEIVGDKLV EVSTIGGVTYERVSKRLA
|
Background | Fatty Acid-Binding Protein 6 (FABP6) is cytoplasmic protein that binds long-chain fatty acids and other hydrophobic ligands which belongs to the calycin superfamily. FABP6 expression is restricted in the small intestine to the ileum where it is involved in the enterohepatic circulation of bile acids. FABP6 forms a beta-barrel structure that accommodates the hydrophobic ligand in its interior. Isoform 2 is expressed in colorectal adenocarcinomas and their adjacent normal mucosa (at protein level). Isoform 1 is expressed in the jejunum, ileum, cecum and ascending colon intestine. FABP6 plays a role in fatty acid uptake, transport, and metabolism. FABP6 stimulates gastric acid and pepsinogen secretion. It seems to be able to bind to bile salts and bilirubins. |