Recombinant Human Fibroblast Growth Factor 12/FGF-12

Instruction Manual!

Product name:	Recombinant Human Fibroblast Growth Factor 12/FGF-12
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 5mM EDTA, pH 7.5.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human Fibroblast Growth Factor 12 is produced by our E.coli expression system and the target gene encoding Met1-Thr181 is expressed.
Names	Fibroblast Growth Factor 12, FGF-12, Fibroblast Growth Factor Homologous Factor 1, FHF-1, Myocyte-Activating Factor, FGF12, FGF12B, FHF1
Accession #	P61328
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 5mM EDTA, pH 7.5.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MESKEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYV AMNGEGYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRVKKT KPSSHFVPKPIEVCMYREQSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDST
Background	Fibroblast Growth Factor 12 (FGF-12) is a member of the fibroblast growth factor (FGF) family. FGF-12 is probably involved in nervous system development and function. FGF-12 lacks the N-terminal signal sequence present in most of the FGF family members, but it contains clusters of basic residues that have been demonstrated to act as a nuclear localization signal. When transfectedinto mammalian cells, this protein accumulated in the nucleus, but was not secreted. The specific function of this gene has not yet been determined. Two alternatively spliced transcript variants encoding distinct isoforms have been reported.