Recombinant Human N-myc Downstream Regulated Gene 1/NDRG1/DRG-1CAP43

Instruction Manual!

Product name:	Recombinant Human N-myc Downstream Regulated Gene 1/NDRG1/DRG-1CAP43
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human NDRG1 is produced by our E.coli expression system and the target gene encoding Met1-Cys394 is expressed with a 6His tag at the N-terminus.
Names	Protein NDRG1, Differentiation-Related Gene 1 Protein, DRG-1, N-myc Downstream-Regulated Gene 1 Protein, Nickel-Specific Induction Protein Cap43, Reducing Agents and Tunicamycin-Responsive Protein, RTP, Rit42, NDRG1, CAP43, DRG1, RTP
Accession #	Q92597
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MGSSHHHHHHSSGLVPRGSHMSREMQDVDLAEVKPLVEKGETITGLLQEFDVQEQDIETLHGSVH VTLCGTPKGNRPVILTYHDIGMNHKTCYNPLFNYEDMQEITQHFAVCHVDAPGQQDGAASFPAGY MYPSMDQLAEMLPGVLQQFGLKSIIGMGTGAGAYILTRFALNNPEMVEGLVLINVNPCAEGWMDW AASKISGWTQALPDMVVSHLFGKEEMQSNVEVVHTYRQHIVNDMNPGNLHLFINAYNSRRDLEIE RPMPGTHTVTLQCPALLVVGDSSPAVDAVVECNSKLDPTKTTLLKMADCGGLPQISQPAKLAEAF KYFVQGMGYMPSASMTRLMRSRTASGSSVTSLDGTRSRSHTSEGTRSRSHTSEGTRSRSHTSEGA HLDITPNSGAAGNSAGPKSMEVSC
Background	Protein NDRG1 is a member of the N-Myc Downregulated Gene family, which is part of the α/β Hydrolase superfamily. Protein NDRG1 is a cytoplasmic protein that is involved in stress responses, hormone responses, cell growth and differentiation. Protein NDRG1 is necessary for p53-mediated caspase activation and apoptosis. Protein NDRG1 mutuations are reported to be the cause for hereditary motor and sensory neuropathy-Lom. Decreased NDRG1 expression in glioma is linked to tumor progression; overexpression of NDRG1 is connected to malignant status of esophageal cancer.