Recombinant Human Myelin P2 Protein/PMP2

Instruction Manual!

Product name:	Recombinant Human Myelin P2 Protein/PMP2
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human Myelin P2 protein is produced by our E.coli expression system and the target gene encoding Met1-Val132 is expressed with a 6His tag at the N-terminus.
Names	Myelin P2 Protein, Peripheral Myelin Protein 2, PMP2
Accession #	P02689
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MGSSHHHHHHSSGLVPRGSHMSNKFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVIISK KGDIITIRTESTFKNTEISFKLGQEFEETTADNRKTKSIVTLQRGSLNQVQRWDGKETTIKRKLV NGKMVAECKMKGVVCTRIYEKV
Background	Myelin P2 Protein (PMP2) is a cytoplasmic protein which belongs to the Fatty-acid binding protein (FABP) family of calycin superfamily. PMP2 is a small, basic, and cytoplasmic lipid binding protein of peripheral myelin. PMP2 is found in peripheral nerve myelin and spinal cord myelin, the oligodendrocytes and Schwann cells, respectively. PMP2 may be involved in lipid transport protein in Schwann cells. It may decrease the inhibitory effect of T suppressors in the culture of immune lymph node cells.