Recombinant Human Prefoldin Subunit 2/PFDN2

Instruction Manual!

Product name:	Recombinant Human Prefoldin Subunit 2/PFDN2
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 50mM NaCl, 1mM DTT, pH 8.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human Prefoldin Subunit 2 is produced by our E.coli expression system and the target gene encoding Met1-Ser154 is expressed with a 6His tag at the N-terminus.
Names	Prefoldin Subunit 2, PFDN2, PFD2
Accession #	Q9UHV9
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 50mM NaCl, 1mM DTT, pH 8.0.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MGSSHHHHHHSSGLVPRGSHMAENSGRAGKSSGSGAGKGAVSAEQVIAGFNRLRQEQRGLASKAA ELEMELNEHSLVIDTLKEVDETRKCYRMVGGVLVERTVKEVLPALENNKEQIQKIIETLTQQLQA KGKELNEFREKHNIRLMGEDEKPAAKENSEGAGAKASSAGVLVS
Background	Prefoldin Subunit 2 (PFDN2) belongs to the Prefoldin Beta subunit family. The PFDN2 protein is one of six subunits of Prefoldin that act as a molecular chaperone complex that binds and stabilizes newly synthesized polypeptides allowing them to fold correctly. PFDN2 binds specifically to Cytosolic Chaperonin (c-CPN) and transfers target proteins to it. PFDN2 also binds to a nascent polypeptide chain and promotes folding in settings where there are many competing pathways for non-native proteins.