Recombinant Human MOB Kinase Activator 1A/MOB1A

Instruction Manual!

Product name:	Recombinant Human MOB Kinase Activator 1A/MOB1A
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM Tris, 0.15M NaCl, pH 8.0 .
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human MOB Kinase Activator 1A is produced by our E.coli expression system and the target gene encoding Ser2-Arg216 is expressed with a 6His tag at the C-terminus.
Names	MOB Kinase Activator 1A, Mob1 Alpha, Mob1A, Mob1 Homolog 1B, Mps One Binder Kinase Activator-like 1B, MOB1A, C2orf6, MOB4B, MOBK1B, MOBKL1B
Accession #	Q9H8S9
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM Tris, 0.15M NaCl, pH 8.0 .
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	SFLFSSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRQAVMLPEGEDLNEWIAVNTVDFFN QINMLYGTITEFCTEASCPVMSAGPRYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETL FPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDSVMQLQEEAHLNTSFKHFIFFVQEFNLI DRRELAPLQELIEKLGSKDRLEHHHHHH
Background	MOB Kinase Activator 1A (MOB1A) belongs to the MOB1/phocein family, which acts as an activator of LATS1/2 in the Hippo signaling pathway, plays a key role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. MOBKL1B stimulates the kinase activity of STK38 and STK38L. MOBKL1B binds to and regulate downstream targets such as the NDR-family protein kinases and LATS1 kinase.