Recombinant Human SGTA

Instruction Manual!

Product name:	Recombinant Human SGTA
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM Tris, 150mM NaCl, pH 8.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human SGTA is produced by our E.coli expression system and the target gene encoding Met1-Glu313 is expressed with a 6His tag at the N-terminus.
Names	Small Glutamine-Rich Tetratricopeptide Repeat-Containing Protein Alpha, Alpha-SGT, Vpu-Binding Protein, UBP, SGTA, SGT, SGT1
Accession #	O43765
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM Tris, 150mM NaCl, pH 8.0.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MGSSHHHHHHSSGLVPRGSHMDNKKRLAYAIIQFLHDQLRHGGLSSDAQESLEVAIQCLETAFGV TVEDSDLALPQTLPEIFEAAATGKEMPQDLRSPARTPPSEEDSAEAERLKTEGNEQMKVENFEAA VHFYGKAIELNPANAVYFCNRAAAYSKLGNYAGAVQDCERAICIDPAYSKAYGRMGLALSSLNKH VEAVAYYKKALELDPDNETYKSNLKIAELKLREAPSPTGGVGSFDIAGLLNNPGFMSMASNLMNN PQIQQLMSGMISGGNNPLGTPGTSPSQNDLASLIQAGQQFAQQMQQQNPELIEQLRSQIRSRTPS ASNDDQQE
Background	Small Glutamine-Rich Tetratricopeptide Repeat-Containing Protein α (SGTA) is an ubiquitously expressed protein which belongs to the SGT Family. SGTA contains three TPR Protein-Protein Interaction Duplicates. SGTA is a co-chaperone that binds directly to HSC70 and HSP70 and regulates their ATPase activity. SGTA is capable of interacting with the major nonstructural protein of Parvovirus H-1 and 70-kDa heat shock cognate protein. It interacts with NS1 from Parvovirus H-1, with Vpu and Gag from HIV-1. It also interacts with SARS-CoV Accessory Protein 7a, DNAJC5 and DNAJC5B. However, its function is not known. Since this transcript is expressed ubiquitously in various tissues, SGTA may serve a housekeeping function.