Recombinant Human Heat-Responsive Protein 12/HRSP12

Instruction Manual!

Product name:	Recombinant Human Heat-Responsive Protein 12/HRSP12
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 100mM NaCl, 1mM DTT, 10% Glycerol, pH 8.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human Heat-Responsive Protein 12 is produced by our E.coli expression system and the target gene encoding Met1-Leu137 is expressed with a 6His tag at the N-terminus.
Names	Ribonuclease UK114, 14.5 kDa Translational Inhibitor Protein, p14.5, Heat-Responsive Protein 12, UK114 Antigen Homolog, HRSP12, PSP
Accession #	P52758
Formulation	Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 100mM NaCl, 1mM DTT, 10% Glycerol, pH 8.0.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MGSSHHHHHHSSGLVPRGSHMSSLIRRVISTAKAPGAIGPYSQAVLVDRTIYISGQIGMDPSSGQ LVSGGVAEEAKQALKNMGEILKAAGCDFTNVVKTTVLLADINDFNTVNEIYKQYFKSNFPARAAY QVAALPKGSRIEIEAVAIQGPLTTASL
Background	Heat-Responsive Protein 12 (HRSP12) is an endoribonuclease that belongs to the Rut family. HRSP12 is found mainly in the human adult kidney and liver and is responsible for inhibiting protein translation by cleaving mRNA. HRSP12 only cleaves phosphodiester bonds in single-stranded RNA and inhibits cell-free protein synthesis. The levels of both mRNA and protein are markedly reduced in heptatocellular tumors and in human hepatoma cell lines compared with normal liver tissues. Moreover the levels of HRSP12 are different depending on the grade of the tumor. This had led to the suggestion that HRSP12 may be an important biomarker for heptatic carcinoma.