Recombinant Human HGPRT/HPRT1

Instruction Manual!

Product name:	Recombinant Human HGPRT/HPRT1
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM Tris, 250mM NaCl, 2mM EDTA, 30% Glycerol, pH 8.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human HGPRT is produced by our E.coli expression system and the target gene encoding Met1-Ala218 is expressed with a 6His tag at the N-terminus.
Names	Hypoxanthine-Guanine Phosphoribosyltransferase, HGPRT, HGPRTase, HPRT1, HPRT
Accession #	P00492
Formulation	Supplied as a 0.2 μm filtered solution of 20mM Tris, 250mM NaCl, 2mM EDTA, 30% Glycerol, pH 8.0.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MGSSHHHHHHSSGLVPRGSHMATRSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDR TERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQS TGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYK PDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKAVEHHHHHH
Background	Hypoxanthine-Guanine Phosphoribosyltransferase (HGPRT) has an important role in the generation of purine nucleotides through the purine salvage pathway. HPRT1 functions to salvage purines from degraded DNA to renewed purine synthesis, it acts as a catalyst in the reaction between guanine and phosphoribosyl pyrophosphate to form GMP.