Recombinant Human Ubiquitin Thioesterase OTUB2/OTUB2

Instruction Manual!

Product name:	Recombinant Human Ubiquitin Thioesterase OTUB2/OTUB2
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 50mM HEPES, 150mM NaCl, 2mM DTT, pH 7.5 .
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human Ubiquitin Thioesterase OTUB2 is produced by our E.coli expression system and the target gene encoding Met1-His234 is expressed with a GST tag at the N-terminus.
Names	Ubiquitin Thioesterase OTUB2, Deubiquitinating Enzyme OTUB2, OTU Comain-Containing Ubiquitin Aldehyde-Binding Protein 2, Otubain-2, Ubiquitin-Specific-Processing Protease OTUB2, OTUB2, C14orf137, OTB2, OTU2
Accession #	Q96DC9
Formulation	Supplied as a 0.2 μm filtered solution of 50mM HEPES, 150mM NaCl, 2mM DTT, pH 7.5 .
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKL TQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEML KMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKS SKYIAWPLQGWQATFGGGDHPPKSDLVPRGSHMSETSFNLISEKCDILSILRDHPENRIYRRKIE ELSKRFTAIRKTKGDGNCFYRALGYSYLESLLGKSREIFKFKERVLQTPNDLLAAGFEEHKFRNF FNAFYSVVELVEKDGSVSSLLKVFNDQSASDHIVQFLRLLTSAFIRNRADFFRHFIDEEMDIKDF CTHEVEPMATECDHIQITALSQALSIALQVEYVDEMDTALNHHVFPEAATPSVYLLYKTSHYNIL YAADKH
Background	Ubiquitin Thioesterase OTUB2 belongs to the peptidase C65 family, functions as a hydrolase that can remove conjugated ubiquitin from proteins in vitro, may plays an important regulatory role at the level of protein turnover by preventing degradation. OTUB2 is expressed at higher levels in the brain.