Recombinant Human α-Soluble NSF Attachment Protein/SNAP-α/NAPA

Instruction Manual!

Product name:	Recombinant Human α-Soluble NSF Attachment Protein/SNAP-α/NAPA
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM Tris, 150mM NaCl, pH 8.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human SNAP-alpha is produced by our E.coli expression system and the target gene encoding Met1-Arg295 is expressed with a 6His tag at the N-terminus.
Names	Alpha-Soluble NSF Attachment Protein, SNAP-Alpha, N-Ethylmaleimide-Sensitive Factor Attachment Protein Alpha, NAPA, SNAPA
Accession #	P54920
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM Tris, 150mM NaCl, pH 8.0.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MGSSHHHHHHSSGLVPRGSHMDNSGKEAEAMALLAEAERKVKNSQSFFSGLFGGSSKIEEACEIY ARAANMFKMAKNWSAAGNAFCQAAQLHLQLQSKHDAATCFVDAGNAFKKADPQEAINCLMRAIEI YTDMGRFTIAAKHHISIAEIYETELVDIEKAIAHYEQSADYYKGEESNSSANKCLLKVAGYAALL EQYQKAIDIYEQVGTNAMDSPLLKYSAKDYFFKAALCHFCIDMLNAKLAVQKYEELFPAFSDSRE CKLMKKLLEAHEEQNVDSYTESVKEYDSISRLDQWLTTMLLRIKKTIQGDEEDLR
Background	α-Soluble NSF Attachment Protein (SNAP-α) is a member of the SNAP (Soluble NSF Attachment Protein) family. SNAP-α interacts with PRKCABP and disrupts the interaction between GRIA2 and PRKCABP, leading to the internalization of GRIA2. SNAP-α is required for vesicular transport between the endoplasmic reticulum and the Golgi apparatus. SNAP-α is in charge of the binding of NSF and therefore the formation of a 20S fusion particle.