Recombinant Human Signaling Threshold-Regulating TM Adapter 1/SIT1

Instruction Manual!

Product name:	Recombinant Human Signaling Threshold-Regulating TM Adapter 1/SIT1
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM Tris, 250mM Nacl, 2mM EDTA, pH 8.0 .
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human SIT1 is produced by our E.coli expression system and the target gene encoding Gln65-Ser196 is expressed with a 6His tag at the N-terminus.
Names	Signaling Threshold-Regulating Transmembrane Adapter 1, SHP2-Interacting Transmembrane Adapter Protein, Suppression-Inducing Transmembrane Adapter 1, gp30/40, SIT1, SIT
Accession #	Q9Y3P8
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM Tris, 250mM Nacl, 2mM EDTA, pH 8.0 .
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MGSSHHHHHHSSGLVPRGSHMQWTRGRSRSHPGQGRSGESVEEVPLYGNLHYLQTGRLSQDPEPD QQDPTLGGPARAAEEVMCYTSLQLRPPQGRIPGPGTPVKYSEVVLDSEPKSQASGPEPELYASVC AQTRRARASFPDQAYANSQPAASLEHHHHHH
Background	Signaling Threshold-Regulating Transmembrane Adapter 1 (SIT1) is a single-pass type I membrane protein and specifically expressed in T- and B-cells. SIT1 interacts with PTPN11/SHP2, GRB2 and CSK, when it is phosphorylated. SIT1 negatively regulates TCR (T-cell antigen receptor)-mediated signaling in T-cell. In addition, SIT1 is involved in positive selection of T-cells.