Recombinant Human Transcription Initiation Factor IIB/TFIIB/GTF2B

Instruction Manual!

Product name:	Recombinant Human Transcription Initiation Factor IIB/TFIIB/GTF2B
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 100mM NaCl, pH 8.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human Transcription Initiation Factor IIB is produced by our E.coli expression system and the target gene encoding Met1-Leu316 is expressed with a GST tag at the N-terminus.
Names	Transcription Initiation Factor IIB, General Transcription Factor TFIIB, S300-II, GTF2B, TF2B, TFIIB
Accession #	Q00403
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 100mM NaCl, pH 8.0.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKL TQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEML KMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKS SKYIAWPLQGWQATFGGGDHPPKSDLVPRGSPEFHMASTSRLDALPRVTCPNHPDAILVEDYRAG DMICPECGLVVGDRVIDVGSEWRTFSNDKATKDPSRVGDSQNPLLSDGDLSTMIGKGTGAASFDE FGNSKYQNRRTMSSSDRAMMNAFKEITTMADRINLPRNIVDRTNNLFKQVYEQKSLKGRANDAIA SACLYIACRQEGVPRTFKEICAVSRISKKEIGRCFKLILKALETSVDLITTGDFMSRFCSNLCLP KQVQMAATHIARKAVELDLVPGRSPISVAAAAIYMASQASAEKRTQKEIGDIAGVADVTIRQSYR LIYPRAPDLFPTDFKFDTPVDKLPQL
Background	Transcription Initiation Factor IIB (TFIIB) is an essential factor for transcription by RNA Polymerase II. TFIIB localizes to the nucleus where it forms a complex (the DAB complex) with transcription factor IID and IIA. TFIIB plays a role as a bridge between IID, which initially recognizes the promoter sequence, and RNA polymerase II. TFIIB is involved in the selection of transcription start site.