Recombinant Human Tropomyosin α-1 Chain/TPM1

Instruction Manual!

Product name:	Recombinant Human Tropomyosin α-1 Chain/TPM1
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM Tris, 1mM DTT, 100mM NaCl, 20% Glycerol, pH 8.0 .
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human Tropomyosin alpha-1 is produced by our E.coli expression system and the target gene encoding Met1-Met284 is expressed with a 6His tag at the N-terminus.
Names	Tropomyosin Alpha-1 Chain, Alpha-Tropomyosin, Tropomyosin-1, TPM1, C15orf13, TMSA
Accession #	P09493
Formulation	Supplied as a 0.2 μm filtered solution of 20mM Tris, 1mM DTT, 100mM NaCl, 20% Glycerol, pH 8.0 .
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MGSSHHHHHHSSGLVPRGSHMDAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVS LQKKLKGTEDELDKYSEALKDAQEKLELAEKKATDAEADVASLNRRIQLVEEELDRAQERLATAL QKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESD LERAEERAELSEGQVRQLEEQLRIMDQTLKALMAAEDKYSQKEDRYEEEIKVLSDKLKEAETRAE FAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMTSM
Background	Tropomyosin α-1 Chain (TPM1) is a member of the Tropomyosin family of highly conserved and widely distributed Actin-binding proteins involved in the contractile system of striated and smooth muscles and the cytoskeleton of non-muscle cells. TPM1 binds to Actin filaments in both muscle and non-muscle cells. It is one type of α-helical chain that forms the predominant Tropomyosin of striated muscle. TPM1 plays a central role in association with the Troponin complex and the Calcium dependent regulation of vertebrate striated muscle contraction. Smooth muscle contraction is regulated by interaction with Caldesmon. In non-muscle cells, it is implicated in stabilizing the cytoskeleton Actin filaments. Defects in TPM1 are associated with type 3 Familial Hypertrophic Cardiomyopathy.