Recombinant Human β-Actin/ACTB

Instruction Manual!

Product name:	Recombinant Human β-Actin/ACTB
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 10mM TrisHCl, 0.1% TritonX-100, 2mM DTT, pH 8.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human beta-Actin is produced by our E.coli expression system and the target gene encoding Asp2-Phe375 is expressed with a 6His tag at the C-terminus.
Names	Actin Cytoplasmic 1, Beta-Actin, ACTB
Accession #	P60709
Formulation	Supplied as a 0.2 μm filtered solution of 10mM TrisHCl, 0.1% TritonX-100, 2mM DTT, pH 8.0.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILT LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPA MYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTER GYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEAL FQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMK IKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCFLEHHHHHH
Background	Actins are ubiquitous globular and highly conserved proteins that are involved in various types of cell motility, structure, and integrity. Three main groups of actin isoforms, alpha, beta and gamma have been identified. The alpha actins are found in muscle tissues and are a major constituent of the contractile apparatus. The beta and gamma actins co-exist in most cell types as components of the cytoskeleton, and as mediators of internal cell motility. ACTB is a major constituent of the contractile apparatus and one of the two nonmuscle cytoskeletal actins. Polymerization of globular actin (G-actin) leads to a structural filament (F-actin) in the form of a two-stranded helix. Each actin can bind to 4 others.