Recombinant Human Aldo-Keto Reductase 1C4/AKR1C4

Instruction Manual!

Product name:	Recombinant Human Aldo-Keto Reductase 1C4/AKR1C4
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, pH 8.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human Aldo-Keto Reductase 1C4 is produced by our E.coli expression system and the target gene encoding Met1-Tyr323 is expressed with a 6His tag at the N-terminus.
Names	Aldo-Keto Reductase Family 1 Member C4, 3-Alpha-HSD1, 3-Alpha-Hydroxysteroid Dehydrogenase Type I, Chlordecone Reductase, CDR, Dihydrodiol Dehydrogenase 4, DD-4, DD4, HAKRA, AKR1C4, CHDR
Accession #	P17516
Formulation	Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, pH 8.0.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MGSSHHHHHHSSGLVPRGSHMDPKYQRVELNDGHFMPVLGFGTYAPPEVPRNRAVEVTKLAIEAG FRHIDSAYLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWCTFFQPQMVQPALESSLKKLQLDY VDLYLLHFPMALKPGETPLPKDENGKVIFDTVDLSATWEVMEKCKDAGLAKSIGVSNFNYRQLEM ILNKPGLKYKPVCNQVECHPYLNQSKLLDFCKSKDIVLVAHSALGTQRHKLWVDPNSPVLLEDPV LCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRENIQVFEFQLTSEDMKVLDGLNRNYRY VVMDFLMDHPDYPFSDEY
Background	Aldo-Keto Reductase 1C4/AKR1C4 is a member of the aldo/keto reductase family that consists of more than 40 known enzymes and proteins. AKR1C4 has highly expressed in Liver. It can catalyzes the bioreduction of chlordecone, a toxic organochlorine pesticide, to chlordecone alcohol in liver. AKR1C4 catalyzes the transformation of the potent androgen dihydrotestosterone (DHT) into the less active form, 5-α-Androstan-3-α,17-β-diol (3-α-diol). In addition, AKR1C4 also has some 20-α-Hydroxysteroid Dehydrogenase activity.