Recombinant Human Argininosuccinate Synthase/ASS1

Instruction Manual!

Product name:	Recombinant Human Argininosuccinate Synthase/ASS1
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 50mM Imidazole, 1mM DTT, 40% Glycerol, pH 7.5.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human Argininosuccinate Synthase is produced by our E.coli expression system and the target gene encoding Met1-Lys412 is expressed with a 6His tag at the N-terminus.
Names	Argininosuccinate Synthase, Citrulline--Aspartate Ligase, ASS1, ASS
Accession #	P00966
Formulation	Supplied as a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 50mM Imidazole, 1mM DTT, 40% Glycerol, pH 7.5.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MGSSHHHHHHSSGLVPRGSHMSSKGSVVLAYSGGLDTSCILVWLKEQGYDVIAYLANIGQKEDFE EARKKALKLGAKKVFIEDVSREFVEEFIWPAIQSSALYEDRYLLGTSLARPCIARKQVEIAQREG AKYVSHGATGKGNDQVRFELSCYSLAPQIKVIAPWRMPEFYNRFKGRNDLMEYAKQHGIPIPVTP KNPWSMDENLMHISYEAGILENPKNQAPPGLYTKTQDPAKAPNTPDILEIEFKKGVPVKVTNVKD GTTHQTSLELFMYLNEVAGKHGVGRIDIVENRFIGMKSRGIYETPAGTILYHAHLDIEAFTMDRE VRKIKQGLGLKFAELVYTGFWHSPECEFVRHCIAKSQERVEGKVQVSVLKGQVYILGRESPLSLY NEELVSMNVQGDYEPTDATGFININSLRLKEYHRLQSKVTAK
Background	Argininosuccinate Synthase (ASS1) is an urea cycle enzyme with a tetrameric structure composed of identical subunits. ASS1 is involved in the synthesis of arginine and catalyzes that condensation of citrulline and aspartate to argininosuccinate using ATP. ASS1 is important to the urea cycle as it catalyzes the important second last step in the arginine biosynthetic pathway. ASS1 mainly expressed in periportal hepatocytes, but also in most other body tissues. A deficiency of ASS1 causes citrullinemia (CTLN1), an autosomal recessive disease which is characterized by severe vomiting spells and mental retardation.