Recombinant Human HDHD2

Instruction Manual!

Product name:	Recombinant Human HDHD2
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 50mM NaCl, pH 8.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human HDHD2 is produced by our E.coli expression system and the target gene encoding Met1-Leu259 is expressed with a 6His tag at the N-terminus.
Names	Haloacid Dehalogenase-Like Hydrolase Domain-Containing Protein 2, HDHD2
Accession #	Q9H0R4
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 50mM NaCl, pH 8.0.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MGSSHHHHHHSSGLVPRGSHMAACRALKAVLVDLSGTLHIEDAAVPGAQEALKRLRGASVIIRFV TNTTKESKQDLLERLRKLEFDISEDEIFTSLTAARSLLERKQVRPMLLVDDRALPDFKGIQTSDP NAVVMGLAPEHFHYQILNQAFRLLLDGAPLIAIHKARYYKRKDGLALGPGPFVTALEYATDTKAT VVGKPEKTFFLEALRGTGCEPEEAVMIGDDCRDDVGGAQDVGMLGILVKTGKYRASDEEKINPPP YLTCESFPHAVDHILQHLL
Background	Haloacid Dehalogenase-Like Hydrolase Domain-Containing Protein 22 (HDHD2) is a member of the HAD-like hydrolase superfamily. HDHD2 includes L-2-Haloacid Dehalogenase, Epoxide Hydrolases and Phosphatases. There are two active sites in HDHD2 - an L-2-Haloacid Dehalogenase and a Carboxylate group. The L-2-Haloacid Dehalogenase active site catalyzes the hydrolytic dehalogenation of D- and L-2-Haloalkanoic Acids, producing L- and D-2-Hydroxyalkanoic Acids.