Recombinant Human Ubiquitin-Conjugating Enzyme E2 A/UBE2A

Instruction Manual!

Product name:	Recombinant Human Ubiquitin-Conjugating Enzyme E2 A/UBE2A
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 50mM HEPES, 150mM NaCl, 2mM DTT, 10% Glycerol, pH 7.5.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human Ubiquitin-Conjugating Enzyme E2 A is produced by our E.coli expression system and the target gene encoding Met1-Cys152 is expressed with a GST, 6His tag at the N-terminus.
Names	Ubiquitin-Conjugating Enzyme E2 A, RAD6 Homolog A, HR6A, hHR6A, Ubiquitin Carrier Protein A, Ubiquitin-Protein Ligase A, UBE2A, RAD6A
Accession #	P49459
Formulation	Supplied as a 0.2 μm filtered solution of 50mM HEPES, 150mM NaCl, 2mM DTT, 10% Glycerol, pH 7.5.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKL TQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEML KMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKS SKYIAWPLQGWQATFGGGDHPPKSDGSTSGSGHHHHHHSAGLVPRGSTAIGMKETAAAKFERQHM DSPDLGTGGGSGDDDDKSPMGSTPARRRLMRDFKRLQEDPPAGVSGAPSENNIMVWNAVIFGPEG TPFEDGTFKLTIEFTEEYPNKPPTVRFVSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQ SLLDEPNPNSPANSQAAQLYQENKREYEKRVSAIVEQSWRDC
Background	Ubiquitin-Conjugating Enzyme E2 (UBE2A) is a member of the E2 Ubiquitin-Conjugating Enzyme family. The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE2A catalyzes the covalent attachment of ubiquitin to other proteins. UBE2A is required for postreplication repair of UV-damaged DNA. UBE2A Interacts with RAD18 and WAC.