Recombinant Human Protein-Tyrosine Phosphatase 1C/PTP1C

Instruction Manual!

Product name:	Recombinant Human Protein-Tyrosine Phosphatase 1C/PTP1C
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 25mM TrisHCl, 2mM β-ME, 1mM EDTA, 1mM DTT, 20% Glycerol, pH 7.5.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human Protein-Tyrosine Phosphatase 1C is produced by our E.coli expression system and the target gene encoding Lys243-Ile541 is expressed with a 6His tag at the C-terminus.
Names	Tyrosine-Protein Phosphatase Non-Receptor Type 6, Hematopoietic Cell Protein-Tyrosine Phosphatase, Protein-Tyrosine Phosphatase 1C, PTP-1C, Protein-Tyrosine Phosphatase SHP-1, SH-PTP1, PTPN6, HCP, PTP1C
Accession #	P29350
Formulation	Supplied as a 0.2 μm filtered solution of 25mM TrisHCl, 2mM β-ME, 1mM EDTA, 1mM DTT, 20% Glycerol, pH 7.5.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MKAGFWEEFESLQKQEVKNLHQRLEGQRPENKGKNRYKNILPFDHSRVILQGRDSNIPGSDYINA NYIKNQLLGPDENAKTYIASQGCLEATVNDFWQMAWQENSRVIVMTTREVEKGRNKCVPYWPEVG MQRAYGPYSVTNCGEHDTTEYKLRTLQVSPLDNGDLIREIWHYQYLSWPDHGVPSEPGGVLSFLD QINQRQESLPHAGPIIVHCSAGIGRTGTIIVIDMLMENISTKGLDCDIDIQKTIQMVRAQRSGMV QTEAQYKFIYVAIAQFIETTKKKLEVLQSQKGQESEYGNILEHHHHHH
Background	Protein-Tyrosine Phosphatase 1C (PTP1C) belongs to the protein-tyrosine phosphatase family.which is known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. PTP1C is highly expressed in leukocyte cell type. It contains two SH2 domains and one tyrosine-protein phosphatase domain. The SH2 regions may interact with other cellular components to modulate its own phosphatase activity against interacting substrates. In addition, PTP1C also modulates signaling by tyrosine phosphorylated cell surface receptors.