Recombinant Human Ubiquitin-Conjugating Enzyme E2 H/UBE2H
Product name: | Recombinant Human Ubiquitin-Conjugating Enzyme E2 H/UBE2H |
Source: | E.coli |
Purity: | Greater than 95% as determined by reducing SDS-PAGE. |
Buffer Formulation: | Supplied as a 0.2 μm filtered solution of 50mM HEPES, 150mM NaCl, 2mM DTT, 10% Glycerol, pH 7.5. |
Applications: | Applications:SDS-PAGE; WB; ELISA; IP. |
Storage: | Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months. |
UOM: | 100ug/50ug/200ug/1mg/1g |
Source | E.coli |
Description | Recombinant Human Ubiquitin-Conjugating Enzyme E2 H is produced by our E.coli expression system and the target gene encoding Met1-Leu183 is expressed with a GST tag at the N-terminus. |
Names | Ubiquitin-Conjugating Enzyme E2 H, UbcH2, Ubiquitin Carrier Protein H, Ubiquitin-Conjugating Enzyme E2-20K, Ubiquitin-Protein Ligase H, UBE2H |
Accession # | P62256 |
Formulation | Supplied as a 0.2 μm filtered solution of 50mM HEPES, 150mM NaCl, 2mM DTT, 10% Glycerol, pH 7.5. |
Shipping |
The product is shipped on dry ice/ice packs. |
Storage |
Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
Endotoxin | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
Amino Acid Sequence |
MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKL TQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEML KMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKS SKYIAWPLQGWQATFGGGDHPPKSDLVPRGSHMSSPSPGKRRMDTDVVKLIESKHEVTILGGLNE FVVKFYGPQGTPYEGGVWKVRVDLPDKYPFKSPSIGFMNKIFHPNIDEASGTVCLDVINQTWTAL YDLTNIFESFLPQLLAYPNPIDPLNGDAAAMYLHRPEEYKQKIKEYIQKYATEEALKEQEEGTGD SSSESSMSDFSEDEAQDMEL
|
Background | Ubiquitin-Conjugating Enzyme E2 H (UBE2H) belongs to the E2 Ubiquitin-Conjugating Enzyme family. The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. It has been shown to conjugate ubiquitin to histone H2A in an E3 dependent manner in vitro. UBE2H is the human homolog to the yeast DNA repair gene RAD6, which is induced by DNA damaging reagents. UBE2H has been associated with cancer-induced cachexia and with the regulation of sepsis-induced muscle proteolysis. |