Recombinant Human Ubiquitin-Conjugating Enzyme E2 K/UBE2K

Instruction Manual!

Product name:	Recombinant Human Ubiquitin-Conjugating Enzyme E2 K/UBE2K
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 50mM HEPES, 150mM NaCl, 2mM DTT, 10% Glycerol, pH 7.5.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human Ubiquitin-Conjugating Enzyme E2 K is produced by our E.coli expression system and the target gene encoding Met1-Asn200 is expressed with a GST tag at the N-terminus.
Names	Ubiquitin-Conjugating Enzyme E2 K, Huntingtin-Interacting Protein 2, HIP-2, Ubiquitin Carrier Protein, Ubiquitin-Conjugating Enzyme E2-25 kDa, Ubiquitin-Conjugating Enzyme E2(25K), Ubiquitin-Conjugating Enzyme E2-25K, Ubiquitin-Protein Ligase, UBE2K, HIP2, LIG
Accession #	P61086
Formulation	Supplied as a 0.2 μm filtered solution of 50mM HEPES, 150mM NaCl, 2mM DTT, 10% Glycerol, pH 7.5.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKL TQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEML KMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKS SKYIAWPLQGWQATFGGGDHPPKSDLVPRGSMANIAVQRIKREFKEVLKSEETSKNQIKVDLVDE NFTELRGEIAGPPDTPYEGGRYQLEIKIPETYPFNPPKVRFITKIWHPNISSVTGAICLDILKDQ WAAAMTLRTVLLSLQALLAAAEPDDPQDAVVANQYKQNPEMFKQTARLWAHVYAGAPVSSPEYTK KIENLCAMGFDRNAVIVALSSKSWDVETATELLLSN
Background	Ubiquitin-Conjugating Enzyme E2 K (UBE2K) belongs to the E2 Ubiquitin-Conjugating Enzyme family. UBE2K is highly expressed in the brain, with highest levels found in cortex and striatum, and at lower levels in cerebellum and brainstem. UBE2K may mediate foam cell formation by the suppression of apoptosis of lipid-bearing macrophages through ubiquitination and subsequence degradation of p53/TP53. UBE2K is associated with the selective degradation of short-lived and abnormal proteins, such as the endoplasmic reticulum-associated degradation (ERAD) of misfolded lumenal proteins. In addition, UBE2K is involved in Alzheimer's disease, Huntington's disease and antigen processing through its interaction with huntingtin, and MHC-heavy chain proteins.