Recombinant Human Hippocalcin-Like Protein 1/HPCAL1

Instruction Manual!

Product name:	Recombinant Human Hippocalcin-Like Protein 1/HPCAL1
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 200mM NaCl, 1mM DTT, 10% Glycerol, pH 8.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human Hippocalcin-Like Protein 1 is produced by our E.coli expression system and the target gene encoding Met1-Phe193 is expressed with a 6His tag at the N-terminus.
Names	Hippocalcin-Like Protein 1, Calcium-Binding Protein BDR-1, HLP2, Visinin-Like Protein 3, VILIP-3, HPCAL1, BDR1
Accession #	P37235
Formulation	Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 200mM NaCl, 1mM DTT, 10% Glycerol, pH 8.0.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MGSSHHHHHHSSGLVPRGSHMGKQNSKLRPEVLQDLRENTEFTDHELQEWYKGFLKDCPTGHLTV DEFKKIYANFFPYGDASKFAEHVFRTFDTNGDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDL DGNGYISRSEMLEIVQAIYKMVSSVMKMPEDESTPEKRTDKIFRQMDTNNDGKLSLEEFIRGAKS DPSIVRLLQCDPSSASQF
Background	Hippocalcin-Like Protein 1 (HPCAL1) is a neuron-specific calcium-binding member of the recoverin family which found in the retina and brain. HPCAL1 contains four EF-hand domains and it is highly similar to human hippocalcin protein. HPCAL1 is involved in the calcium-dependent regulation of rhodopsin phosphorylation. In addition, it may be of relevance for neuronal signalling in the central nervous system.