Recombinant Human Ubiquitin-Conjugating Enzyme E2 T/UBE2T

Instruction Manual!

Product name:	Recombinant Human Ubiquitin-Conjugating Enzyme E2 T/UBE2T
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 50mM HEPES, 150mM NaCl, 2mM DTT, 10% Glycerol, pH 7.5.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human Ubiquitin-Conjugating Enzyme E2 T is produced by our E.coli expression system and the target gene encoding Met1-Val197 is expressed with a 6His tag at the N-terminus.
Names	Ubiquitin-Conjugating Enzyme E2 T, Cell Proliferation-Inducing Gene 50 Protein, Ubiquitin Carrier Protein T, Ubiquitin-Protein Ligase T, UBE2T
Accession #	Q9NPD8
Formulation	Supplied as a 0.2 μm filtered solution of 50mM HEPES, 150mM NaCl, 2mM DTT, 10% Glycerol, pH 7.5.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MGSSHHHHHHSSGLVPRGSHMQRASRLKRELHMLATEPPPGITCWQDKDQMDDLRAQILGGANTP YEKGVFKLEVIIPERYPFEPPQIRFLTPIYHPNIDSAGRICLDVLKLPPKGAWRPSLNIATVLTS IQLLMSEPNPDDPLMADISSEFKYNKPAFLKNARQWTEKHARQKQKADEEEMLDNLPEAGDSRVH NSTQKRKASQLVGIEKKFHPDV
Background	Ubiquitin-Conjugating Enzyme E2 T (UBE2T) is a ligase that belongs to the Ubiquitin-Conjugating Enzyme family. UBE2T accepts the ATP-dependent ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro, UBE2T is able to catalyze polyubiquitination using all 7 ubiquitin Lys residues, but may prefer 'Lys-11'-, 'Lys-27'-, 'Lys-48'- and 'Lys-63'-linked polyubiquitination. UBE2T is an important factor of the Faconi anemia pathway of DNA damage repair and, upon self-inactivation, may negatively regulate the Faconi pathway.