Recombinant Human Stratifin/SFN

Instruction Manual!

Product name:	Recombinant Human Stratifin/SFN
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 250mM NaCl, 1mM EDTA, 1mM DTT, pH 7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human Stratifin is produced by our E.coli expression system and the target gene encoding Met1-Ser248 is expressed.
Names	14-3-3 Protein Sigma, Epithelial Cell Marker Protein 1, Stratifin, SFN, HME1
Accession #	P31947
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 250mM NaCl, 1mM EDTA, 1mM DTT, pH 7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSI EQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRY LAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAK TTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS
Background	Stratifin (SFN) belongs to the 14-3-3 family of proteins that act as important regulators of intracelluar signal transduction through their ability to bind specific motifs phosphorylated on serine or threonine. There are at least seven isoforms that have been identified in mammals (beta, gamma, epsilon, sigma, zeta, tau and eta). SFN can detected in many tissues, highly expressed in stratified squamous keratinizing epithelium. SFN is indicated as an epithelial cell marker and serves as a tumor suppressor whose expression can be down regulated by methylation. In addition, SFN plays a key role in maintaining the G2 checkpoint in cells and preventing mitotic death.