Recombinant Human γ-Glutamylcyclotransferase/GGCT

Instruction Manual!

Product name:	Recombinant Human γ-Glutamylcyclotransferase/GGCT
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, pH 8.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human gamma-Glutamylcyclotransferase is produced by our E.coli expression system and the target gene encoding Met1-Leu188 is expressed with a 6His tag at the N-terminus.
Names	Gamma-Glutamylcyclotransferase, Cytochrome C-Releasing Factor 21, GGCT, C7orf24, CRF21
Accession #	O75223
Formulation	Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, pH 8.0.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MGSSHHHHHHSSGLVPRGSHMANSGCKDVTGPDEESFLYFAYGSNLLTERIHLRNPSAAFFCVAR LQDFKLDFGNSQGKTSQTWHGGIATIFQSPGDEVWGVVWKMNKSNLNSLDEQEGVKSGMYVVIEV KVATQEGKEITCRSYLMTNYESAPPSPQYKKIICMGAKENGLPLEYQEKLKAIEPNDYTGKVSEE IEDIIKKGETQTL
Background	Human Υ-Glutamylcyclotransferase belongs to the Transferases family, specifically the Aminoacyltransferase. Gamma-Glutamylcyclotransferase catalyzes the formation of 5-Pxoproline from Gamma-Glutamyl Dipeptides. It plays an important role in Glutathione Homeostasis. Gamma-Glutamylcyclotransferase induces the release of Cytochrome C from the mitochondria resulting in the induction of apoptosis.