Recombinant Human C-Reactive Protein/CRP

Instruction Manual!

Product name:	Recombinant Human C-Reactive Protein/CRP
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mMTris，2MUrea，pH8.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human CRP is produced by our E.coli expression system and the target gene encoding Gln19-Pro224 is expressed with a 6His tag at the C-terminus.
Names	C-Reactive Protein, CRP, PTX1
Accession #	P02741
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mMTris，2MUrea，pH8.0.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKAFTVCLHFYTELSSTRGYSIFSYATKRQDNEIL IFWSKDIGYSFTVGGSEILFEVPEVTVAPVHICTSWESASGIVEFWVDGKPRVRKSLKKGYTVGA EASIILGQEQDSFGGNFEGSQSLVGDIGNVNMWDFVLSPDEINTIYLGGPFSPNVLNWRALKYEV QGEVFTKPQLWPLEHHHHHH
Background	C-reactive protein (CRP) belongs to the pentaxin family. CRP is a secreted protein found in plasma. It can binds two calcium ions per subunit.CRP can promotes phagocytosis, bacterial capsular swelling, complement fixation and agglutination through its calcium-dependent binding to phosphorylcholine which expressed on the surface of dead or dying cells. It can activate the complement system via the C1Q complex. CRP can interact with DNA and histones. In addition, CRP may scavenge nuclear material released from damaged circulating cells.