Recombinant Human PAF-AH subunit β/PAFAHB

Instruction Manual!

Product name:	Recombinant Human PAF-AH subunit β/PAFAHB
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM Tris, 150mM NaCl, pH 8.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human PAF-AH subunit beta is produced by our E.coli expression system and the target gene encoding Ser2-Ala229 is expressed with a 6His tag at the C-terminus.
Names	Platelet-Activating Factor Acetylhydrolase IB Subunit Beta, PAF Acetylhydrolase 30 kDa Subunit, PAF-AH 30 kDa Subunit, PAF-AH Subunit Beta, PAFAH Subunit Beta, PAFAH1B2, PAFAHB
Accession #	P68402
Formulation	Supplied as a 0.2 μm filtered solution of 20mM Tris, 150mM NaCl, pH 8.0.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	SQGDSNPAAIPHAAEDIQGDDRWMSQHNRFVLDCKDKEPDVLFVGDSMVQLMQQYEIWRELFSPL HALNFGIGGDTTRHVLWRLKNGELENIKPKVIVVWVGTNNHENTAEEVAGGIEAIVQLINTRQPQ AKIIVLGLLPRGEKPNPLRQKNAKVNQLLKVSLPKLANVQLLDTDGGFVHSDGAISCHDMFDFLH LTGGGYAKICKPLHELIMQLLEETPEEKQTTIAVEHHHHHH
Background	Platelet-Activating Factor Acetylhydrolase IB Subunit β (PAFAHB) is a cytoplasmic hydrolase. PAFAHB is a member of the GDSL lipolytic enzyme family. It also belongs to Platelet-activating factor acetylhydrolase IB beta/gamma subunits subfamily. Cytosolic PAF-AH IB is formed of three subunits of 45 kDa (alpha), 30 kDa (beta) and 29 kDa (gamma), PAFAHB is a catalytic subunit. PAFAHB inactivates PAF by removing the acetyl group at the sn-2 position.