Recombinant Human Protein Phosphatase 1G/PP1MG

Instruction Manual!

Product name:	Recombinant Human Protein Phosphatase 1G/PP1MG
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 25mM TrisHCl, 1mM DTT, 1mM EDTA, 2mM β-ME, 20% Glycerol, pH 7.5.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human PP1MG is produced by our E.coli expression system and the target gene encoding Met317-Asp546 is expressed with a 6His tag at the C-terminus.
Names	Protein Phosphatase 1G, Protein Phosphatase 1C, Protein Phosphatase 2C Isoform Gamma, PP2C-Gamma, Protein Phosphatase Magnesium-Dependent 1 Gamma, PPM1G, PPM1C
Accession #	O15355
Formulation	Supplied as a 0.2 μm filtered solution of 25mM TrisHCl, 1mM DTT, 1mM EDTA, 2mM β-ME, 20% Glycerol, pH 7.5.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MEGKEEPGSDSGTTAVVALIRGKQLIVANAGDSRCVVSEAGKALDMSYDHKPEDEVELARIKNAG GKVTMDGRVNGGLNLSRAIGDHFYKRNKNLPPEEQMISALPDIKVLTLTDDHEFMVIACDGIWNV MSSQEVVDFIQSKISQRDENGELRLLSSIVEELLDQCLAPDTSGDGTGCDNMTCIIICFKPRNTA ELQPESGKRKLEEVLSTEGAEENGNSDKKKKAKRDLEHHHHHH
Background	Protein Phosphatase 1G (PP1MG) is a cytoplasmic protein that belongs to the PP2C family. PPM1G is widely expressed; it is abundant in testis, skeletal muscle, and heart. PPM1G is a negative regulator of cell stress response pathways. PPM1G is responsible for the dephosphorylation of Pre-mRNA splicing factors, an important factor for the formation of functional spliceosome. PPM1G also plays a role in regulating cell cycle progression.