Recombinant Human Protein Phosphatase 1A/PPM1A

Instruction Manual!

Product name:	Recombinant Human Protein Phosphatase 1A/PPM1A
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human PPM1A is produced by our E.coli expression system and the target gene encoding Gly2-Trp382 is expressed with a 6His tag at the C-terminus.
Names	Protein Phosphatase 1A, Protein Phosphatase 2C Isoform Alpha, PP2C-Alpha, Protein Phosphatase IA, PPM1A, PPPM1A
Accession #	P35813
Formulation	Supplied as a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MGAFLDKPKMEKHNAQGQGNGLRYGLSSMQGWRVEMEDAHTAVIGLPSGLESWSFFAVYDGHAGS QVAKYCCEHLLDHITNNQDFKGSAGAPSVENVKNGIRTGFLEIDEHMRVMSEKKHGADRSGSTAV GVLISPQHTYFINCGDSRGLLCRNRKVHFFTQDHKPSNPLEKERIQNAGGSVMIQRVNGSLAVSR ALGDFDYKCVHGKGPTEQLVSPEPEVHDIERSEEDDQFIILACDGIWDVMGNEELCDFVRSRLEV TDDLEKVCNEVVDTCLYKGSRDNMSVILICFPNAPKVSPEAVKKEAELDKYLECRVEEIIKKQGE GVPDLVHVMRTLASENIPSLPPGGELASKRNVIEAVYNRLNPYKNDDTDSTSTDDMWLEHHHHHH
Background	Protein Phosphatase 1A (PPM1A) is a member of the PP2C family of Ser/Thr protein phosphatases which are known to be negative regulators of cell stress response pathways. PPM1A has a broad specificity. PPM1A negatively regulates the activities of MAP kinases and MAP kinase kinases. Also, it negatively regulates TGF-beta signaling through dephosphorylating SMAD2 and SMAD3, resulting in their dissociation from SMAD4, nuclear export of the SMADs and termination of the TGF-beta-mediated signaling. In addition, PPM1A can dephosphorylate cyclin-dependent kinases, and thus may be involved in cell cycle control.