Recombinant Human Glutamate Oxaloacetate Transaminase 1/GOT1

Instruction Manual!

Product name:	Recombinant Human Glutamate Oxaloacetate Transaminase 1/GOT1
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 100mM NaCl, 2mM DTT, 20% Glycerol, pH 7.5 .
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human Glutamate Oxaloacetate Transaminase 1 is produced by our E.coli expression system and the target gene encoding Ala2-Leu414 is expressed with a 6His tag at the C-terminus.
Names	Aspartate Aminotransferase Cytoplasmic, Glutamate Oxaloacetate Transaminase 1, Transaminase A, GOT1
Accession #	P17174
Formulation	Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 100mM NaCl, 2mM DTT, 20% Glycerol, pH 7.5 .
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	APPSVFAEVPQAQPVLVFKLTADFREDPDPRKVNLGVGAYRTDDCHPWVLPVVKKVEQKIANDNS LNHEYLPILGLAEFRSCASRLALGDDSPALKEKRVGGVQSLGGTGALRIGADFLARWYNGTNNKN TPVYVSSPTWENHNAVFSAAGFKDIRSYRYWDAEKRGLDLQGFLNDLENAPEFSIVVLHACAHNP TGIDPTPEQWKQIASVMKHRFLFPFFDSAYQGFASGNLERDAWAIRYFVSEGFEFFCAQSFSKNF GLYNERVGNLTVVGKEPESILQVLSQMEKIVRITWSNPPAQGARIVASTLSNPELFEEWTGNVKT MADRILTMRSELRARLEALKTPGTWNHITDQIGMFSFTGLNPKQVEYLVNEKHIYLLPSGRINVS GLTTKNLDYVATSIHEAVTKIQLEHHHHHH
Background	Glutamate Oxaloacetate Transaminase 1 (GOT1) is a cytoplasmic protein. GOT1 belongs to the class-I pyridoxal-phosphate-dependent aminotransferase family. GOT1 is a pyridoxal phosphate-dependent enzyme that exists in cytoplasmic and mitochondrial forms. GOT1 plays a key role in amino acid metabolism and the urea and tricarboxylic acid cycles. GOT1 involves in L-methionine salvage from methylthioadenosine, aspartate catabolic process, cellular response to insulin stimulus, polyamine metabolic process, and glucocorticoid stimulus.